-
C4 Original Pre Workout Powder
$20.00Hard Hitting EnergyMuscular EnduranceAI-Powered PeptidesEnhanced Focus
–
OthersLowest Cost/Serving✔️Effective for All Levels✔️Variety of Flavors✔️Formula Strength✔️ -
C4 Ultimate Pre Workout Powder
$25.00
Make your training hit harder than ever with the revamped C4 Ultimate – tailored for workout warriors who demand nothing but the best. Our new Tri-Stim formula packs a potent punch of 300mg of Caffeine, TeaCrine®, and Dynamine™, for the ultimate high-stim energy experience that makes your old PR feel like your new warmup weight. Next up, PeptiPump®, an AI-powered designer peptide exclusive to C4, boosts performance while Tyrosine and Huperzine A keep you in the zone for a strong mind-muscle connection. Leave no reps in the tank with enhanced muscular endurance from CarnoSyn® Beta-Alanine*, BetaPower®, and the patented Velox® Performance Blend for hard-hitting pumps and enhanced performance. Experience the pinnacle of pumps, energy, and focus with the newly enhanced C4 Ultimate – backed by the 20-year legacy of C4’s innovation in sports nutrition.*
^Studies have shown benefits of CarnoSyn® Beta-Alanine to be correlated with cumulative use.
Key Features:
- TRI-STIM ENERGY: Experience unstoppable energy with our tri-stim blend of 300mg Caffeine + TeaCrine® + Dynamine™.*
- HARD HITTING PUMPS: Made with VELOX®: a patented mix of L-Arginine + L-Citrulline for seriously satisfying pumps & performance.*
- MUSCULAR ENDURANCE^: Smash through plateaus and keep hitting harder with enhanced muscular endurance from CarnoSyn® Beta-Alanine + BetaPower®.*
- ENHANCED MENTAL FOCUS: Get in the zone for a strong mind-to-muscle connection with Tyrosine + Huperzine A + Caffeine.*
- AI-POWERED PEPTIDES: PeptiPump® is an AI-powered designer peptide exclusively found in C4.*
- C4: Backed by 20 years of sports nutrition expertise, we’ve raised the bar with an innovative selection of supplements.
Ingredients:
- 300mg Caffeine: Ultimate energy + enhanced focus.*
- Dynamine™: Compliments Caffeine to help support increased energy. *
- TeaCrine®: Supports increased energy, mood, and focus when in combination with Caffeine.*
- Huperzine A: In conjunction with Caffeine, supports enhanced focus.*
- Tyrosine: Supports cognitive function under physical stress.*
- Velox® Performance Blend: A patented combination of L-Citrulline and L-Arginine designed to support performance, pump, and recovery.*
- CarnoSyn® Beta-Alanine*: Clinically studied ingredient that helps support muscular endurance and combat muscular fatigue.*
- BetaPower®: Clinically studied ingredient naturally derived form of betaine, from beets, that helps maintain muscle cell hydration.*
- Creatine Nitrate (NO3-T®): Supports increased pump and training performance.*
- PeptiPump® Bioactive Lentil Peptides: Used in combination with VELOX® Performance Blend and Creatine Nitrate to support increased pump and training performance.*
^Studies have shown benefits of CarnoSyn® Beta-Alanine to be correlated with cumulative use.
THIS PRODUCT IS ONLY INTENDED TO BE CONSUMED BY HEALTHY ADULTS, 18 YEARS OF AGE OR OLDER. Do not use this product if you are pregnant, nursing, or are currently taking nitrates for chest pain or if you are taking medication used to treat erectile dysfunction such as PDE-5 inhibitors. Before using this product, consult a licensed, qualified, healthcare professional, including but not limited to, if: you are taking antidepressants such as MAOI (Monoamine Oxidase Inhibitor) or SSRI, blood thinners, nonsteroidal anti-inflammatory drugs, pseudoephedrine, or you are taking any other dietary supplement, prescription drug or over-the-counter medication; or if, you suspect you have or have been treated for, diagnosed with or have a family history of, any medical condition, including but not limited to: high or low blood pressure, diabetes, glaucoma, anxiety, cardiovascular, psychiatric or seizure disorders, cardiac arrhythmia, stroke, heart, liver, kidney or thyroid disease, or difficulty urinating due to prostate enlargement. This product contains Caffeine and should not be used by individuals wishing to eliminate Caffeine from their diet or in combination with Caffeine or stimulants from other sources including but not limited to, coffee, tea, soda, or other dietary supplements and medications. Discontinue 2 weeks prior to surgery. Immediately discontinue use and contact a medical doctor if you experience any adverse reaction to this product. Do not exceed recommendations for Suggested Use. Use only as directed. Do not use if safety seal is broken or missing. Store in a cool dry place. KEEP OUT OF REACH OF CHILDREN.
-
Sale!
Cagrilintide 5mg
Original price was: $65.00.$48.00Current price is: $48.00.Product Description
Chemical Information:
- Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅
- Molecular Weight: 3946.32 g/mol
- Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity)
- Molecular Structure: Refer to Certificate of Analysis for detailed structural information.
Description:
Cagrilintide is a synthetic long-acting analog of human amylin, a peptide extensively studied for its potential roles in appetite regulation, energy balance, and metabolic control. Engineered for prolonged receptor activation, Cagrilintide supports research into mechanisms governing satiety, food intake, weight management, and metabolic signaling pathways. Provided as a lyophilized powder, it is ideal for advanced research into metabolic function, energy homeostasis, and obesity-related pathways.
Research Applications:
Cagrilintide is actively studied for potential roles in:- Appetite and Weight Regulation: Investigating effects on food intake suppression and satiety signaling pathways.
- Metabolic Control: Evaluating impacts on glucose metabolism, insulin sensitivity, and lipid profile improvements.
- Obesity Research: Examining mechanisms underlying sustained weight loss and energy balance modulation.
- Gastrointestinal and Neuroendocrine Studies: Exploring interactions with gastrointestinal motility, nutrient absorption, and central signaling pathways involved in hunger and satiety.
Storage and Handling:
- Store lyophilized powder at -20°C.
- After reconstitution, refrigerate at 2-8°C and use promptly.
- Maintain aseptic handling practices to ensure sterility and product integrity.
Product Specifications:
- Purity: ≥99% (HPLC Verified)
- Appearance: Lyophilized white powder
- Solubility: Soluble in bacteriostatic water
Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.
References:
Referenced scientific publications include:- Lau, D. C., et al. (2021). “Cagrilintide, a Long-Acting Amylin Analogue, for Weight Management in Adults with Overweight and Obesity: A Randomised, Controlled, Phase 2 Trial.” The Lancet.
- Enebo, L. B., et al. (2021). “Safety, Tolerability, and Efficacy of Cagrilintide for Weight Management: Findings from a Phase 1 Clinical Study.” Diabetes, Obesity and Metabolism.
-
Cardiogen 25 mg
$49.00Save up to 20% on bulk ordersRange (Qty) Price 3 – 4 $47.23 5 – 6 $46.05 7 – 9 $44.87 10 – 19 $43.10 20 + $37.20 -
Cardiogen 25 mg
$49.00Save up to 20% on bulk ordersRange (Qty) Price 3 – 4 $47.23 5 – 6 $46.05 7 – 9 $44.87 10 – 19 $43.10 20 + $37.20 -
Cartalax 25 mg
$49.00CAS NO: 124596-98-1
Molecular Formula: C12H19N3O8
Molecular Weight: 333.29 g/mol
Appearance: white powder
Storage: 2-8°
Purity: ≥99% -
-
CJC-1295 (no DAC) | Ipamorelin 5/5 mg
$45.00The product is a blend of CJC-1295 (no DAC) and Ipamorelin.
Appearance: white powder
Storage: 2-8°
Purity: ≥99 -
CJC-1295 (no DAC) | Ipamorelin 5/5 mg
$45.00The product is a blend of CJC-1295 (no DAC) and Ipamorelin.
Appearance: white powder
Storage: 2-8°
Purity: ≥99 -
CJC-1295 DAC (5mg)
$38.00Size: 5mg
Contents: CJC-1295 with DAC (5mg)
Form: Lyophilized powder
Purity: >99%
SKU: P-CJC1295-5 -
CJC-1295 DAC 2mg
$55.00CJC-1295 is a synthetic analogue of growth hormone releasing hormone (GHRH) that increases plasma levels of growth hormone and insulin-like growth factor 1 (IGF-1). DAC is an additive moiety that prolongs the plasma half-life of CJC-1295.
-
CJC-1295 DAC 5mg
$67.99CJC-1295 is a synthetic analogue of growth hormone releasing hormone (GHRH) that increases plasma levels of growth hormone and insulin-like growth factor 1 (IGF-1). DAC is an additive moiety that prolongs the plasma half-life of CJC-1295.
-
Buy T3 25 mcg|100 tabs $54.60 -
Retatrutide 5mg (LY3437943), 99.6% purity peptide (TFA removed) Original price was: $84.00.$66.00Current price is: $66.00.
